missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Otx1 Monoclonal antibody specifically detects Otx1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Otx1 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6H7J9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | FLJ38361, homeobox protein OTX1, MGC15736, orthodenticle (Drosophila) homolog 1, orthodenticle homeobox 1, Orthodenticle homolog 1, orthodenticle homolog 1 (Drosophila) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Otx1 (P32242). MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?