missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OTUD7B/Cezanne/ZA20D1 Antibody, Novus Biologicals™

OTUD7B/Cezanne/ZA20D1 Antibody, Novus Biologicals™

Product Code. 18432551 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18432551 25 μL 25µL
18729813 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18432551 Supplier Novus Biologicals Supplier No. NBP18809525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OTUD7B/Cezanne/ZA20D1 Polyclonal specifically detects OTUD7B/Cezanne/ZA20D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen OTUD7B/Cezanne/ZA20D1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne
Gene Symbols OTUD7B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Mucosal Immunology
Primary or Secondary Primary
Gene ID (Entrez) 56957
Test Specificity Specificity of human OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.