missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
OSBPL9 Polyclonal antibody specifically detects OSBPL9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | OSBPL9 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | FLJ12492, FLJ14629, FLJ14801, FLJ32055, FLJ34384, ORP-9, ORP9MGC15035, OSBP4, OSBP-related protein 9, oxysterol binding protein-like 9, oxysterol-binding protein-related protein 9 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKDQSNAEKHADGM |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?