missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OSBPL11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | OSBPL11 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OSBPL11 Polyclonal specifically detects OSBPL11 in Human samples. It is validated for Western Blot.Specifications
| OSBPL11 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 114885 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ13012, FLJ13164, ORP11OSBP-related protein 11, ORP-11TCCCIA00292, OSBP12, oxysterol binding protein-like 11, oxysterol-binding protein-related protein 11 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL11 (NP_073613.2). Peptide sequence KNSSCGGGISSSSSSRGGSAKGWQYSDHMENVYGYLMKYTNLVTGWQYRF | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title