missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ORC4L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ORC4L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ORC4L Polyclonal specifically detects ORC4L in Human samples. It is validated for Western Blot.Specifications
| ORC4L | |
| Polyclonal | |
| Rabbit | |
| O43929 | |
| 5000 | |
| Synthetic peptides corresponding to ORC4L(origin recognition complex, subunit 4-like (yeast)) The peptide sequence was selected from the middle region of ORC4L. Peptide sequence VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast) | |
| ORC4 | |
| IgG | |
| This product is specific to Subunit or Isoform: 4. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title