OR8B4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09816-100UL

Product Code. 18371215

Description

OR8B4 Polyclonal specifically detects OR8B4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR8B4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 8B4, Olfactory receptor OR11-315, olfactory receptor, family 8, subfamily B, member 4, olfactory receptor, family 8, subfamily B, member 4 pseudogene, OR11-315, OR8B4P
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8B4 (NP_001005196). Peptide sequence TYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLALGKTLKR
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 283162
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.