missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR6C70 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | OR6C70 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
OR6C70 Polyclonal specifically detects OR6C70 in Human samples. It is validated for Western Blot.Specifications
| OR6C70 | |
| Polyclonal | |
| Purified | |
| RUO | |
| olfactory receptor 6C70, olfactory receptor, family 6, subfamily C, member 70 | |
| OR6C70 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| A6NIJ9 | |
| 390327 | |
| Synthetic peptides corresponding to OR6C70(olfactory receptor, family 6, subfamily C, member 70) The peptide sequence was selected from the C terminal of OR6C70. Peptide sequence GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title