OR6C1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18382775	Novus Biologicals NBP3-09676-100UL	100 μg

Description

OR6C1 Polyclonal specifically detects OR6C1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR6C1
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: olfactory receptor, family 6, subfamily C, member 1, OST267olfactory receptor 6C1
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6C1 (NP_001005182). Peptide sequence PSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILN
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 390321
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.