missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR5T2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | OR5T2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OR5T2 Polyclonal specifically detects OR5T2 in Human samples. It is validated for Western Blot.Specifications
| OR5T2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| olfactory receptor 5T2, Olfactory receptor OR11-177, olfactory receptor, family 5, subfamily T, member 2, OR11-177 | |
| OR5T2 | |
| IgG | |
| 39 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6IFC8 | |
| 219464 | |
| Synthetic peptides corresponding to OR5T2(olfactory receptor, family 5, subfamily T, member 2) The peptide sequence was selected from the C terminal of OR5T2. Peptide sequence DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title