missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR5P3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10236-100UL
This item is not returnable.
View return policy
Description
OR5P3 Polyclonal specifically detects OR5P3 in Mouse samples. It is validated for Western Blot.
Specifications
| OR5P3 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| JCG1, olfactory receptor 5P3, Olfactory receptor OR11-94, olfactory receptor, family 5, subfamily P, member 3, Olfactory receptor-like protein JCG1 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR5P3 (NP_666984.1). Peptide sequence MPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNKDVKEAMKKLMANTHH | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 120066 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion