missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR5H6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | OR5H6 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR5H6 Polyclonal specifically detects OR5H6 in Mouse samples. It is validated for Western Blot.Specifications
| OR5H6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 79295 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| olfactory receptor 5H6, Olfactory receptor OR3-11, olfactory receptor, family 5, subfamily H, member 6, OR3-11 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR5H6. Peptide sequence VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title