missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OR52W1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

OR52W1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18350315 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18350315 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Produktkod. 18350315 Leverantör Novus Biologicals Leverantörsnummer NBP309870100UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

OR52W1 Polyclonal specifically detects OR52W1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen OR52W1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias olfactory receptor 52W1, Olfactory receptor OR11-71, olfactory receptor, family 52, subfamily W, member 1, olfactory receptor, family 52, subfamily W, member 1 pseudogene, OR11-71, OR52W1P
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52W1 (NP_001005178). Peptide sequence VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 120787
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.