missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
OR51V1 Polyclonal specifically detects OR51V1 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | OR51V1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Odorant receptor HOR3'beta1, Olfactory receptor 51A12, olfactory receptor 51V1, Olfactory receptor OR11-36, olfactory receptor, family 51, subfamily V, member 1, OR11-36, OR51A12 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51V1 (NP_001004760). Peptide sequence YYALMLVICILLLDAILILFSYILILKSVLAVASQEERHKLFQTCISHIC |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?