OR4S2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09658-100UL

Product Code. 18315144

Description

OR4S2 Polyclonal specifically detects OR4S2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR4S2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 4S2, Olfactory receptor OR11-137, olfactory receptor, family 4, subfamily S, member 2, olfactory receptor, family 4, subfamily S, member 2 pseudogene, OR11-137, OR4S2P, OST725
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4S2 (NP_001004059). Peptide sequence VVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGSHIAMV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 219431
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.