missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
OR4F6 Polyclonal specifically detects OR4F6 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | OR4F6 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | olfactory receptor 4F6, olfactory receptor, family 4, subfamily F, member 6, OR15-15, OR4F12 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4F6 (NP_001005326). Peptide sequence FISLASFLILIISYIFILVTVQKKSSGGIFKAFSMLSAHVIVVVLVFGPL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?