missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR2M2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | OR2M2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR2M2 Polyclonal specifically detects OR2M2 in Human samples. It is validated for Western Blot.Specifications
| OR2M2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 2M2, olfactory receptor, family 2, subfamily M, member 2, OST423OR2M2Q | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2M2 (NP_001004688). Peptide sequence DKMVSVFYTILTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYV | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 391194 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts