missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OR1F1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

OR1F1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18371044 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18371044 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18371044 Supplier Novus Biologicals Supplier No. NBP309758100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OR1F1 Polyclonal specifically detects OR1F1 in Human samples. It is validated for Western Blot, Antibody Array Analysis.
TRUSTED_SUSTAINABILITY

Specifications

Antigen OR1F1
Applications Western Blot, Peptide Array
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Antibody Array Analysis
Formulation PBS buffer, 2% sucrose
Gene Alias Olfactory receptor 16-35, olfactory receptor 1F1, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory receptor 1F8, Olfactory receptor 1F9, Olfactory receptor OR16-4, olfactory receptor, family 1, subfamily F, member 1, olfactory receptor, family 1, subfamily F, member 13 pseudogene, olfactory receptor, family 1, subfamily F, member 4, olfactory receptor, family 1, subfamily F, member 5, olfactory receptor, family 1, subfamily F, member 6, olfactory receptor, family 1, subfamily F, member 7, olfactory receptor, family 1, subfamily F, member 9, Olfmf, OLFMFolfactory receptor, family 1, subfamily F, member 10, OR16-35, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F10, OR1F13P, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR3-145, ORL1023
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 (NP_036492.1). Peptide sequence FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4992
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.