missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR1C1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OR1C1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OR1C1 Polyclonal specifically detects OR1C1 in Human samples. It is validated for Western Blot.Specifications
| OR1C1 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| 26188 | |
| Synthetic peptides corresponding to OR1C1 (olfactory receptor, family 1, subfamily C, member 1) The peptide sequence was selected from the C terminal of OR1C1. Peptide sequence AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HSTPCR27, olfactory receptor 1C1, Olfactory receptor OR1-42, Olfactory receptor TPCR27, olfactory receptor, family 1, subfamily C, member 1, OR1.5.10, OR1-42, ORL211, TPCR27 | |
| OR1C1 | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title