missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR1A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10274-100UL
This item is not returnable.
View return policy
Description
OR1A1 Polyclonal specifically detects OR1A1 in Human samples. It is validated for Western Blot.
Specifications
| OR1A1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| olfactory receptor 1A1, Olfactory receptor OR17-11, olfactory receptor, family 1, subfamily A, member 1, OR17-7Olfactory receptor 17-7 | |
| The immunogen is a synthetic peptide directed towards the middle region of human OR1A1 (NP_055380.2). Peptide sequence RSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLS | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8383 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction