missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR11H12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OR11H12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OR11H12 Polyclonal specifically detects OR11H12 in Human samples. It is validated for Western Blot.Specifications
| OR11H12 | |
| Polyclonal | |
| Rabbit | |
| olfactory receptor 11H12, olfactory receptor, family 11, subfamily H, member 12 | |
| OR11H12 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 440153 | |
| Synthetic peptides corresponding to OR11H12(olfactory receptor, family 11, subfamily H, member 12) The peptide sequence was selected from the N terminal of OR11H12. Peptide sequence CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title