missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Optineurin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£290.00 - £460.00
Specifications
| Antigen | Optineurin |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Immunohistochemistry-Frozen 1:10-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18478750
|
Novus Biologicals
NBP1-84682-25ul |
25 μL |
£290.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18767123
|
Novus Biologicals
NBP1-84682 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Optineurin Polyclonal specifically detects Optineurin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| Optineurin | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| FIP2FIP-2, GLC1Eglaucoma 1, open angle, E (adult-onset), HIP7ALS12, Huntingtin interacting protein L, Huntingtin yeast partner L, Huntingtin-interacting protein 7, Huntingtin-interacting protein L, HYPLHIP-7, NEMO-related protein, NRPE3-14.7K-interacting protein, Optic neuropathy-inducing protein, optineurin, TFIIIA-INTP, Transcription factor IIIA-interacting protein, transcrption factor IIIA-interacting protein, tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains | |
| OPTN | |
| IgG | |
| Affinity Purified | |
| Specificity of human Optineurin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Immunohistochemistry-Frozen 1:10-1:500 | |
| Polyclonal | |
| Rabbit | |
| Immunology, Innate Immunity, Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10133 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title