OLT-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18403172	Novus Biologicals NBP2-30759-25ul	25 μL
18190175	Novus Biologicals NBP2-30759	0.1 mL

Description

OLT-2 Polyclonal specifically detects OLT-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OLT-2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: OSCAR-Like Transcript-2 Protein, T Cell-Interacting, Activating Receptor On Myeloid Cells, T Cell-Interacting, Activating Receptor On Myeloid Cells 1, TARM1, T-Cell-Interacting, Activating Receptor On Myeloid Cells Protein 1
• Gene Symbols: TARM1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: B6A8C7
• Gene ID (Entrez): 441864
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFVPIMFALLKAGTPSPIQLQSPAGKEIDFSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only