missing translation for 'onlineSavingsMsg'
Learn More

Olig2 Antibody (3C9), Novus Biologicals™

Product Code. 18339539 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18339539 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18339539 Supplier Novus Biologicals Supplier No. H00010215M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Olig2 Monoclonal antibody specifically detects Olig2 in Human, Feline samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Olig2
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3C9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 10 μg/mL, Immunohistochemistry-Paraffin 1:10-1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005797
Gene Alias BHLHB1, BHLHE19, Class B basic helix-loop-helix protein 1, Class E basic helix-loop-helix protein 19, human protein kinase C-binding protein RACK17, OLIGO2, oligodendrocyte lineage transcription factor 2, oligodendrocyte transcription factor 2, oligodendrocyte-specific bHLH transcription factor 2, protein kinase C binding protein 2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17helix-loop-helix protein, class B, 1
Host Species Mouse
Immunogen OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cellular Markers, Chromatin Research, Glia Markers, Neuroscience, Oligodendrocyte Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 10215
Target Species Human, Feline
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.