missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18408809

Olig1 Antibody (3E3), Novus Biologicals™

Product Code. 18408809 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18408809 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18408809 Supplier Novus Biologicals Supplier No. H00116448M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Olig1 Monoclonal antibody specifically detects Olig1 in Human samples. It is validated for ELISA, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen Olig1
Applications ELISA, Immunoprecipitation
Classification Monoclonal
Clone 3E3
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_620450
Gene Alias bHLHb6, BHLHE21, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21, helix-loop-helix protein, class B, 6, oligo1, oligodendrocyte lineage transcription factor 1, oligodendrocyte transcription factor 1, oligodendrocyte-specific bHLH transcription factor 1
Host Species Mouse
Immunogen OLIG1 (NP_620450.1, 80 a.a. ∽ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 116448
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.