missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Olfactory receptor 181 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Olfactory receptor 181 Polyclonal specifically detects Olfactory receptor 181 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Olfactory receptor 181 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactory receptor 181 (NP_667210.2). Peptide sequence NSNKDIPVGVFYTIVIPLLNPFIYSLRNKEVVNAVKKVMKTHSIFKNSSA |
| Purification Method | Affinity purified |
| Quantity | 100 μg |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?