OGDHL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91486

Product Code. 18322941

Description

OGDHL Polyclonal specifically detects OGDHL in Human samples. It is validated for Western Blot, Knockdown Validated.

Specifications

• Antigen: OGDHL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: mitochondrial, OGDC-E1-like, oxoglutarate dehydrogenase-like
• Host Species: Rabbit
• Molecular Weight of Antigen: 114 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 85%; Bovine: 85%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, KnockDown Validated
• Gene Accession No.: NP_060715
• Gene Symbols: OGDHL
• Immunogen: Synthetic peptide directed towards the N terminal of human OGDHL. Peptide sequence VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55753
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.