missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ODF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ODF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18337992
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18337992 25 μg 25µL
18336786 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18337992 Supplier Bio-Techne Supplier No. NBP31713925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ODF4 Polyclonal antibody specifically detects ODF4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ODF4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias cancer/testis antigen 134, cancer/testis antigen 136, CT134, CT136, hOPPO1, MGC138215, OPPO1MGC138219, outer dense fiber 4, outer dense fiber of sperm tails 4, Outer dense fiber of sperm tails protein 4, outer dense fiber protein 4, Testis-specific protein oppo 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 146852
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.