missing translation for 'onlineSavingsMsg'
Learn More

ODF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18336786
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μg
25 μg
missing translation for 'unitSize'
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18336786 100 μg 100µL
18337992 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18336786 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP317139100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

ODF4 Polyclonal antibody specifically detects ODF4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ODF4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias cancer/testis antigen 134, cancer/testis antigen 136, CT134, CT136, hOPPO1, MGC138215, OPPO1MGC138219, outer dense fiber 4, outer dense fiber of sperm tails 4, Outer dense fiber of sperm tails protein 4, outer dense fiber protein 4, Testis-specific protein oppo 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 146852
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.