ODF3L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP3-17406-25UL

Codice prodotto. 18369436

Descrizione

ODF3L2 Polyclonal antibody specifically detects ODF3L2 in Human samples. It is validated for Immunofluorescence

Specifica

• Antigen: ODF3L2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: C19orf19, Chromosome 19 Open Reading Frame 19, Outer Dense Fiber Of Sperm Tails 3-Like 2, Outer Dense Fiber Protein 3-Like Protein 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 284451
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG