OCTN2/SLC22A5 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93859-0.1ml

Product Code. 18697250

Description

OCTN2/SLC22A5 Polyclonal antibody specifically detects OCTN2/SLC22A5 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: OCTN2/SLC22A5
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000
• Gene Alias: CDSP, FLJ46769, High-affinity sodium-dependent carnitine cotransporter, OCTN2high-affinity sodium dependent carnitine cotransporter, OCTN2VT, organic cation transporter 2, organic cation transporter 5, Organic cation/carnitine transporter 2, SCD, solute carrier family 22 (organic cation transporter), member 5, solute carrier family 22 (organic cation/carnitine transporter), member 5, solute carrier family 22 member 5
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-142 of human OCTN2/SLC22A5 (O76082). LIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKA
• Quantity: 0.1 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 6584
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified