missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCTN2/SLC22A5 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93859-0.02ml
This item is not returnable.
View return policy
Description
OCTN2/SLC22A5 Polyclonal antibody specifically detects OCTN2/SLC22A5 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| OCTN2/SLC22A5 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| CDSP, FLJ46769, High-affinity sodium-dependent carnitine cotransporter, OCTN2high-affinity sodium dependent carnitine cotransporter, OCTN2VT, organic cation transporter 2, organic cation transporter 5, Organic cation/carnitine transporter 2, SCD, solute carrier family 22 (organic cation transporter), member 5, solute carrier family 22 (organic cation/carnitine transporter), member 5, solute carrier family 22 member 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 42-142 of human OCTN2/SLC22A5 (O76082). LIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKA | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 6584 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction