missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OBFC2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | OBFC2A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18233512
|
Novus Biologicals
NBP2-58805 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605348
|
Novus Biologicals
NBP2-58805-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OBFC2A Polyclonal specifically detects OBFC2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| OBFC2A | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, oligonucleotide/oligosaccharide-binding fold containing 2A, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2, Sensor of ssDNA subunit B2, SOSS complex subunit B2, SOSS-B2, SSB2Single-stranded DNA-binding protein 2 | |
| NABP1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 64859 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title