missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OAT1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£150.00 - £366.00
Specifications
| Antigen | OAT1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18641691
|
Novus Biologicals
NBP2-94474-0.02ml |
0.02 mL |
£150.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605621
|
Novus Biologicals
NBP2-94474-0.1ml |
0.1 mL |
£366.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OAT1 Polyclonal antibody specifically detects OAT1 in Human, Rat samples. It is validated for Western BlotSpecifications
| OAT1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Rat | |
| hOAT1, hPAHT, hROAT1, MGC45260, OAT1FLJ55736, Organic anion transporter 1, PAH transporter, PAHTHOAT1, para-aminohippurate transporter, Renal organic anion transporter 1, ROAT1, solute carrier family 22 (organic anion transporter), member 6, solute carrier family 22 member 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 31-135 of human OAT1 (NP_004781.2). MASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 9356 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title