O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52925

Product Code. 18256984

Description

O-GlcNAc Transferase p110 subunit Polyclonal specifically detects O-GlcNAc Transferase p110 subunit in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: O-GlcNAc Transferase p110 subunit
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1, EC 2.4.1.255 FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: O15294
• Gene Symbols: OGT
• Immunogen: Synthetic peptides corresponding to OGT(O-linked N-acetylglucosamine (GlcNAc) transferase) The peptide sequence was selected from the N terminal of OGT. Peptide sequence ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE.
• Quantity: 100 μL
• Research Discipline: Amino Acids Drugs and other small molecules, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers
• Gene ID (Entrez): 8473
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only