NXT2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93010-0.02ml

Product Code. 18600701

Beskrivning

NXT2 Polyclonal antibody specifically detects NXT2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifikationer

• Antigen: NXT2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Gene Alias: BM-025, NTF2-related export protein 2, nuclear transport factor 2-like export factor 2, protein p15-2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2). GLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNT
• Quantity: 0.02 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55916
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified