missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NXT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NXT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NXT1 Polyclonal specifically detects NXT1 in Human samples. It is validated for Western Blot.Specifications
| NXT1 | |
| Polyclonal | |
| Rabbit | |
| NP_037380 | |
| 29107 | |
| Synthetic peptide directed towards the N terminal of human NXT1The immunogen for this antibody is NXT1. Peptide sequence GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MTR2NTF2-related export protein 1, NTF2-like export factor 1, NTX2-like export factor1, NUTF-like export factor 1, P15, Protein p15 | |
| NXT1 | |
| IgG | |
| 16 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title