missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £451.00
Specifications
| Antigen | NUT |
|---|---|
| Concentration | 0.4mg/mL |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18417390
|
Novus Biologicals
NBP1-84176-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18758383
|
Novus Biologicals
NBP1-84176 |
0.1 mL |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUT Polyclonal specifically detects NUT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NUT | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C15orf55, chromosome 15 open reading frame 55, DKFZp434O192, FAM22H, MGC138683, MGC138684, Nuclear protein in testis, NUT, protein NUT | |
| NUTM1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.4mg/mL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 256646 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title