missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NUT Antibody, Novus Biologicals™

NUT Antibody, Novus Biologicals™

Product Code. 18417390 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18417390 25 μL 25µL
18758383 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18417390 Supplier Novus Biologicals Supplier No. NBP18417625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivelse

Rabbit Polyclonal Antibody

NUT Polyclonal specifically detects NUT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NUT
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.4mg/mL
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C15orf55, chromosome 15 open reading frame 55, DKFZp434O192, FAM22H, MGC138683, MGC138684, Nuclear protein in testis, NUT, protein NUT
Gene Symbols NUTM1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 256646
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.