missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUP98 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | NUP98 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18255833
|
Novus Biologicals
NBP2-57805 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611099
|
Novus Biologicals
NBP2-57805-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUP98 Polyclonal specifically detects NUP98 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NUP98 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Mitotic Regulators | |
| ADAR2, ADIR2, GLFG-repeat containing nucleoporin, nuclear pore complex protein Nup98-Nup96, nucleoporin 98kD, nucleoporin 98kDa, NUP196, NUP96, Nup98-Nup96 | |
| NUP98 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4928 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title