missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NUP50 Monoclonal antibody specifically detects NUP50 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
Specifications
| Antigen | NUP50 |
| Applications | Western Blot, ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 4H7 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_705931 |
| Gene Alias | 50 kDa nucleoporin, MGC39961, NPAP60, NPAP60LNucleoporin Nup50, nuclear pore complex protein Nup50, Nuclear pore-associated protein 60 kDa-like, nuclear pore-associated protein 60L, nucleoporin 50kD, nucleoporin 50kDa |
| Host Species | Mouse |
| Immunogen | NUP50 (NP_705931.1, 342 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?