missing translation for 'onlineSavingsMsg'
Learn More

NUP133 Antibody (3E8), Novus Biologicals™

Product Code. 18375859 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18375859 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18375859 Supplier Novus Biologicals Supplier No. H00055746M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

NUP133 Monoclonal antibody specifically detects NUP133 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NUP133
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3E8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100 to 1:2000, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_060700
Gene Alias FLJ10814, hNUP133,133 kDa nucleoporin, MGC21133, nuclear pore complex protein Nup133, nucleoporin 133kD, nucleoporin 133kDa, Nucleoporin Nup133
Host Species Mouse
Immunogen NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55746
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.