missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | NUDT9 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639918
|
Novus Biologicals
NBP2-48818-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677875
|
Novus Biologicals
NBP2-48818 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUDT9 Polyclonal antibody specifically detects NUDT9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NUDT9 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 53343 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, ADP-ribose pyrosphosphatase NUDT9, ADPR-PPase, EC 3.6.1.13, MGC3037, mitochondrial, nucleoside diphosphate linked moiety X-type motif 9, nudix (nucleoside diphosphate linked moiety X)-type motif 9, Nudix motif 9, NUDT10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title