NUDT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49205-25ul

Product Code. 18632209

Description

NUDT3 Polyclonal antibody specifically detects NUDT3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NUDT3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Diadenosine 5'-5'''-P1, diphosphoinositol polyphosphate phosphohydrolase 1, DIPP-1, DIPPDIPP1, EC 3.6.1.-, EC 3.6.1.52, Nucleoside diphosphate-linked moiety X motif 3, nudix (nucleoside diphosphate linked moiety X)-type motif 3, Nudix motif 3, P6-hexaphosphate hydrolase 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRQGYSANNGTPVVATTYSVSAQSSMSGIR
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 11165
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified