missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nucleoporin 107 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33250-20ul
This item is not returnable.
View return policy
Description
Nucleoporin 107 Monoclonal antibody specifically detects Nucleoporin 107 in Human,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Nucleoporin 107 | |
| Monoclonal | |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| nuclear pore complex protein Nup107, nucleoporin 107kDa, NUP84Nucleoporin Nup107,107 kDa nucleoporin | |
| A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Nucleoporin 107 (P57740).,, Sequence:, LASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFG | |
| 20 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 57122 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction