Novus Biologicals™ Nucleobindin 1 Recombinant Protein Antigen

Codice prodotto. 18393841

Marca: Novus Biologicals™ NBP188217PEP

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUCB1. The Nucleobindin 1 Recombinant Protein Antigen is derived from E. coli. The Nucleobindin 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-88217. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifica

• Gene ID (Entrez): 4924
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: NUCB1
• Label Type: Unlabeled
• Molecular Weight (g/mol): 29kDa
• Product Type: Nucleobindin 1
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88217. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: EGWETVEMHPAYTEEELRRFEEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDVPVPA

For Research Use Only