missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUCKS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37908-100ul
This item is not returnable.
View return policy
Description
NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NUCKS1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).,, Sequence:, ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 64710 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction