NUBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18448900	Novus Biologicals NBP1-84533-25ul	25 μL
18256027	Novus Biologicals NBP1-84533	0.1 mL

Description

NUBP2 Polyclonal specifically detects NUBP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NUBP2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10101
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CFD1C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) ), cytosolic Fe-S cluster assembly factor NUBP2, homolog of yeast cytosolic Fe-S cluster deficient 1, NBP 2, NUBP1, nucleotide binding protein 2 (E.coli MinD like), nucleotide binding protein 2 (MinD homolog, E. coli), Nucleotide-binding protein 2
• Gene Symbols: NUBP2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only