missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | NUBP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NUBP1 Polyclonal specifically detects NUBP1 in Human samples. It is validated for Western Blot.Specifications
| NUBP1 | |
| Polyclonal | |
| Rabbit | |
| P53384 | |
| 4682 | |
| Synthetic peptides corresponding to NUBP1 (nucleotide binding protein 1 (MinD homolog, E. coli)) The peptide sequence was selected from the N terminal of NUBP1. Peptide sequence MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1 | |
| NUBP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title