missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NTPCR Antibody, Novus Biologicals™

NTPCR Antibody, Novus Biologicals™

Product Code. 30232840 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30232840 20 μL 20µL
30227431 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30232840 Supplier Novus Biologicals Supplier No. NBP33548720ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NTPCR Polyclonal antibody specifically detects NTPCR in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen NTPCR
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias C1orf57, chromosome 1 open reading frame 57, EC 3.6.1.15, FLJ11383, HCR-NTPase, human cancer-related NTPase, MGC13186, NTPase, Nucleoside triphosphate phosphohydrolase, nucleoside-triphosphatase C1orf57, nucleoside-triphosphatase, cancer-related, RP4-678E16.2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1).,, Sequence:, LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 84284
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.