missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NTPCR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35487-100ul
This item is not returnable.
View return policy
Description
NTPCR Polyclonal antibody specifically detects NTPCR in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| NTPCR | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| C1orf57, chromosome 1 open reading frame 57, EC 3.6.1.15, FLJ11383, HCR-NTPase, human cancer-related NTPase, MGC13186, NTPase, Nucleoside triphosphate phosphohydrolase, nucleoside-triphosphatase C1orf57, nucleoside-triphosphatase, cancer-related, RP4-678E16.2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1).,, Sequence:, LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK | |
| 100 μL | |
| Protein Kinase | |
| 84284 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction