NTPCR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35487-100ul

Product Code. 30227431

Beskrivning

NTPCR Polyclonal antibody specifically detects NTPCR in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifikationer

• Antigen: NTPCR
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: C1orf57, chromosome 1 open reading frame 57, EC 3.6.1.15, FLJ11383, HCR-NTPase, human cancer-related NTPase, MGC13186, NTPase, Nucleoside triphosphate phosphohydrolase, nucleoside-triphosphatase C1orf57, nucleoside-triphosphatase, cancer-related, RP4-678E16.2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1).,, Sequence:, LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 84284
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified